ATG4B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP257210

Catalog No. NBP257210

Description

ATG4B Polyclonal specifically detects ATG4B in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: ATG4B
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: APG4 autophagy 4 homolog B, APG4 autophagy 4 homolog B (S. cerevisiae), APG4B, ATG4 autophagy related 4 homolog B (S. cerevisiae), AUTL1MGC1353, AUT-like 1 cysteine endopeptidase, Autophagin-1, Autophagy-related cysteine endopeptidase 1, Autophagy-related protein 4 homolog B, cysteine protease ATG4B, DKFZp586D1822, EC 3.4.22, EC 3.4.22.-, hAPG4B, KIAA0943
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: ATG4B
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FCKTEDDFNDWCQQVKKLSLLGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEILSL
• Quantity: 100 μL
• Research Discipline: Autophagy, Cancer
• Gene ID (Entrez): 23192
• Target Species: Human
• Isotype: IgG

For Research Use Only