Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ATP10D Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP159982
Description
ATP10D Polyclonal specifically detects ATP10D in Human samples. It is validated for Western Blot.Specifications
ATP10D | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
ATPase, class V, type 10D, ATPVDtype IV aminophospholipid transporting ATPase, EC 3.6.3, EC 3.6.3.1, KIAA1487ATPase class V type 10D, probable phospholipid-transporting ATPase VD | |
Rabbit | |
Affinity purified | |
RUO | |
57205 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q9P241 | |
ATP10D | |
Synthetic peptides corresponding to ATP10D(ATPase, class V, type 10D) The peptide sequence was selected from the C terminal of ATP10D. Peptide sequence LFTSAPPVIYGVLEKDVSAETLMQLPELYRSGQKSEAYLPHTFWITLLDA. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Guinea pig: 92%; Equine: 92%; Pig: 92%; Canine: 91%; Rabbit: 91%; Bovine: 85%; Mouse: 78%. | |
Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction