Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ATP5H Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP17947920UL

 View more versions of this product

Catalog No. NBP17947920


Add to cart

Description

Description

ATP5H Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

ATP5H
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
ATP5H
Synthetic peptide directed towards the C terminal of human ATP5HThe immunogen for this antibody is ATP5H. Peptide sequence CAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKY.
18 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Western Blot
Western Blot 0.2-1 ug/ml
NP_006347
ATP synthase D chain, mitochondrial, ATP synthase subunit d, mitochondrial, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit d, ATP synthase, H+ transporting, mitochondrial F1F0, subunit d, ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d, ATP5JD, ATPase subunit d, ATPQ, My032 protein
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
10476
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit