Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ATP6V0E2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15510020UL
Description
ATP6V0E2 Polyclonal specifically detects ATP6V0E2 in Human samples. It is validated for Western Blot.Specifications
ATP6V0E2 | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
ATPase, H+ transporting V0 subunit e2, chromosome 7 open reading frame 32, H+ transporting V0 subunit E isoform 2-like (rat), Lysosomal 9 kDa H(+)-transporting ATPase V0 subunit e2 | |
Rabbit | |
17-19 kDa | |
20 μL | |
Primary | |
This product is specific to Subunit or Isoform: e 2. | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
ATP6V0E2 | |
Synthetic peptides corresponding to ATP6V0E2(ATPase, H+ transporting V0 subunit e2) The peptide sequence was selected from the middle region of ATP6V0E2. Peptide sequence TVAPLSLTTPSSGPSPTQLCLVTSSLLLAPRDPDPQGLPGSWKSSQSSQP. | |
Affinity Purified | |
RUO | |
155066 | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction