Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ATP6V1A Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP155212

 View more versions of this product

Catalog No. NBP155212


Add to cart

Description

Description

ATP6V1A Polyclonal antibody specifically detects ATP6V1A in Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit samples. It is validated for Western Blot.
Specifications

Specifications

ATP6V1A
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
ATP6V1A
Synthetic peptides corresponding to ATP6V1A(ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A) The peptide sequence was selected from the N terminal of ATP6V1A. Peptide sequence SGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPR.
68 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
This product is specific to Subunit or Isoform: A.
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat
Western Blot
Western Blot 0.2-1 ug/ml
P38606
70kD, isoform 1, ATP6A1, ATP6V1A1ATPase, H+ transporting, lysosomal, subunit A1, ATPase, H+ transporting, lysosomal (vacuolar proton pump), alpha polypeptide, ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A, EC 3.6.3, EC 3.6.3.14, H(+)-transporting two-sector ATPase, subunit A, H+-transporting ATPase chain A, vacuolar (VA68 type), HO68, VA68, vacuolar ATP synthase catalytic subunit A, ubiquitous isoform, Vacuolar ATPase isoform VA68, vacuolar proton pump alpha subunit 1, Vacuolar proton pump subunit alpha, V-ATPase 69 kDa subunit, V-ATPase 69 kDa subunit 1, V-ATPase A subunit 1, V-ATPase subunit A, Vma1, VPP2, V-type proton ATPase catalytic subunit A
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
523
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit