Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ATP6V1B2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | ATP6V1B2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP154759
|
Novus Biologicals
NBP154759 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
ATP6V1B2 Polyclonal specifically detects ATP6V1B2 in Human samples. It is validated for Western Blot.Specifications
| ATP6V1B2 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 000 subunit, 56/58kD, isoform 2, ATP6B2ATPase, H+ transporting, lysosomal (vacuolar proton pump), beta polypeptide, ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B2, Endomembrane proton pump 58 kDa subunit, H+ transporting two-sector ATPase, HO57ATP6B1B2, vacuolar H+-ATPase 56, Vacuolar proton pump subunit B 2, VATB, V-ATPase B2 subunit, V-ATPase subunit B 2, Vma2, VPP3ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B, isoform 2, V-type proton ATPase subunit B, brain isoform | |
| ATP6V1B2 | |
| IgG | |
| Affinity Purified | |
| This product is specific to Subunit or Isoform: B, brain isoform. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| P21281 | |
| 526 | |
| Synthetic peptides corresponding to ATP6V1B2(ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B2) The peptide sequence was selected from the N terminal of ATP6V1B2. Peptide sequence VSRNYLSQPRLTYKTVSGVNGPLVILDHVKFPRYAEIVHLTLPDGTKRSG | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. | |
| 56 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title