Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ATP7A Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP31030925UL

 View more versions of this product

Catalog No. NB125520


Add to cart

Description

Description

ATP7A Polyclonal antibody specifically detects ATP7A in Human samples. It is validated for Western Blot
Specifications

Specifications

ATP7A
Unconjugated
PBS buffer, 2% sucrose
ATPase, Cu++ transporting, alpha polypeptide, Copper pump 1, copper-transporting ATPase 1, Cu++-transporting P-type ATPase, DSMAX, EC 3.6.3, EC 3.6.3.4, MC1, Menkes disease-associated protein, Menkes syndrome, MK, MNKFLJ17790, OHS, SMAX3
The immunogen is a synthetic peptide directed towards the middle region of human ATP7A (NP_000043). Peptide sequence SSLFLKLYRKPTYESYELPARSQIGQKSPSEISVHVGIDDTSRNSPKLGL
25 μg
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Polyclonal
Human
Western Blot
Western Blot 1.0 ug/ml
Purified
Rabbit
Affinity purified
RUO
Primary
538
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit