Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ATPAF1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Specifications

Antigen ATPAF1
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB126190
View Documents
Novus Biologicals
NBP31064425UL
25 μg N/A
NB126189
View Documents
Novus Biologicals
NBP310644100UL
100 μg N/A
Description

Description

ATPAF1 Polyclonal antibody specifically detects ATPAF1 in Human samples. It is validated for Western Blot
Specifications

Specifications

ATPAF1
Western Blot
Purified
RUO
PBS buffer, 2% sucrose
64756
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Human
ATP synthase mitochondrial F1 complex assembly factor 1, ATP11 homolog, ATP11ATP11p, Atp11p, FLJ22351, homolog of yeast ATP11, MGC88060
The immunogen is a synthetic peptide directed towards the middle region of human ATPAF1 (NP_073582). Peptide sequence KQPVGHSRQGDFIKCVEQKTDALGKQSVNRGFTKDKTLSSIFNIEMVKEK
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit