Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Aurora C Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15499420UL

 View more versions of this product

Catalog No. NBP15499420

Add to cart



Aurora C Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.


Aurora C
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
Synthetic peptides corresponding to AURKC(aurora kinase C) The peptide sequence was selected from the middle region of AURKC. Peptide sequence TYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPL.
34 kDa
Cell Cycle and Replication
Western Blot
Western Blot 1:100-1:2000
AIE2AIK3, ARK3Serine/threonine-protein kinase aurora-C, AurC, aurora kinase CAurora/IPL1/Eg2 protein 2, Aurora/IPL1-related kinase 3, aurora-C, Aurora-related kinase 3, EC 2.7.11, EC, serine/threonine kinase 13 (aurora/IPL1-like), serine/threonine-protein kinase 13, STK13ARK-3
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit