Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Autoimmune Regulator/AIRE Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $320.71

Specifications

Antigen Autoimmune Regulator/AIRE
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB126799
View Documents
Novus Biologicals
NBP310950100UL
100 μg
Each for $320.71
Add to cart
 
NB126800
View Documents
Novus Biologicals
NBP31095025UL
25 μg
Each for $106.19
Add to cart
 
Description

Description

Autoimmune Regulator/AIRE Polyclonal antibody specifically detects Autoimmune Regulator/AIRE in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications

Specifications

Autoimmune Regulator/AIRE
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Purified
RUO
Human, Mouse
APECED protein, APECEDAPSI, Autoimmune polyendocrinopathy candidiasis ectodermal dystrophy protein, autoimmune regulator, autoimmune regulator (APECED protein)10APS1AIRE1, autoimmune regulator (autoimmune polyendocrinopathy candidiasis ectodermaldystrophy), PGA1
The immunogen is a synthetic peptide directed towards the N terminal region of human Autoimmune Regulator/AIRE (NP_000374). Peptide sequence HRTEIAVAVDSAFPLLHALADHDVVPEDKFQETLHLKEKEGCPQAFHALL
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
Unconjugated
Rabbit
Immune System Diseases, Immunology
PBS buffer, 2% sucrose
326
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit