Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Autoimmune Regulator/AIRE Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | Autoimmune Regulator/AIRE |
---|---|
Dilution | Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin |
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NB126799
|
Novus Biologicals
NBP310950100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
Autoimmune Regulator/AIRE Polyclonal specifically detects Autoimmune Regulator/AIRE in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Autoimmune Regulator/AIRE | |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
Immune System Diseases, Immunology | |
PBS buffer, 2% sucrose | |
326 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin | |
Polyclonal | |
Purified | |
RUO | |
Human, Mouse | |
APECED protein, APECEDAPSI, Autoimmune polyendocrinopathy candidiasis ectodermal dystrophy protein, autoimmune regulator, autoimmune regulator (APECED protein)10APS1AIRE1, autoimmune regulator (autoimmune polyendocrinopathy candidiasis ectodermaldystrophy), PGA1 | |
The immunogen is a synthetic peptide directed towards the N terminal region of human Autoimmune Regulator/AIRE (NP_000374). Peptide sequence HRTEIAVAVDSAFPLLHALADHDVVPEDKFQETLHLKEKEGCPQAFHALL | |
Affinity purified |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title