Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AWAT1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP159865
Description
AWAT1 Polyclonal specifically detects AWAT1 in Human samples. It is validated for Western Blot.Specifications
AWAT1 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
acyl-CoA wax alcohol acyltransferase 1, DGA2, DGAT2L3, diacyl-glycerol acyltransferase 2, Diacylglycerol acyltransferase 2, diacylglycerol O-acyltransferase 2-like 3, Diacylglycerol O-acyltransferase 2-like protein 3, EC 2.3.1.75, Long-chain-alcohol O-fatty-acyltransferase 1 | |
Rabbit | |
38 kDa | |
100 μL | |
Primary | |
Expected to cross react based on sequence identity: Porcine 85%, Equine 86%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q58HT5 | |
AWAT1 | |
Synthetic peptides corresponding to AWAT1 (acyl-CoA wax alcohol acyltransferase 1) Antibody(against the N terminal of AWAT1. Peptide sequence NWCVWTHIRDYFPITILKTKDLSPEHNYLMGVHPHGLLTFGAFCNFCTEA. | |
Affinity purified | |
RUO | |
158833 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction