B4GALT5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP16901820UL

Catalog No. NBP16901820

Description

B4GALT5 Polyclonal specifically detects B4GALT5 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: B4GALT5
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000
• Gene Accession No.: Q9JMK0
• Gene Symbols: B4GALT5
• Immunogen: Synthetic peptides corresponding to B4galt5 (UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 5) The peptide sequence was selected from the C terminal of B4galt5. Peptide sequence GYSVSRPEGDTGKYKSIPHHHRGEVQFLGRYALLRKSKERQGLDG
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9334
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: B4Gal-T5, beta-1,4-galactosyltransferase 5, Beta-1,4-GalT II, beta-1,4-GalT IV, Beta-1,4-GalTase 5, beta-1.4-galactosyltransferase V, beta4-GalT IV, Beta4Gal-T5, BETA4-GALT-IV, beta4GalT-V, EC 2.4.1.-, gt-V, MGC138470, UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 5, UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 5, UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 5, UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 5
• Host Species: Rabbit
• Molecular Weight of Antigen: 45 kDa
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Mouse
• Isotype: IgG