Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ BAMBI (Human) Recombinant Protein (P01)

Human Recombinant Protein

Manufacturer:  Abnova™ H00025805P01

Catalog No. 89-968-730


Add to cart

Description

Description

Human BAMBI full-length ORF ( AAH19252, 1 a.a. - 260 a.a.) recombinant protein with GST-tag at N-terminal.
Specifications

Specifications

Human
Antibody Production,Array,ELISA,Western Blot
25805
12.5% SDS-PAGE Stained with Coomassie Blue
Wheat Germ (in vitro)
NMA
Recombinant
AAH19252
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in. the elution buffer
BMP and activin membrane-bound inhibitor homolog (Xenopus laevis)
2 µg
Store at -80°C Aliquot to avoid repeated freezing and thawing
BAMBI
MDRHSSYIFIWLQLELCAMAVLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNSNSPLTHGCLDSLASTTDICQAKQARNHSGTTIPTLECCHEDMCNYRGLHDVLSPPRGEASGQGNRYQHDGSRNLITKVQELTSSKELWFRAAVIAVPIAGGLTLVLLIMLALRMLRSENKRLQDQRQQMLSRLHYSFHGHHSKKGQVAKLDLECMVPVSGHENCCLTCDKMRQADLSNDKILSLVHWGMYSGHGKLEFV
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit