Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BBS1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17968420UL
Description
BBS1 Polyclonal specifically detects BBS1 in Mouse samples. It is validated for Western Blot.Specifications
BBS1 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_001028300 | |
BBS1 | |
Synthetic peptide directed towards the N terminal of human Bbs1The immunogen for this antibody is Bbs1. Peptide sequence PCVYVYKNLRPYFKFSLPQLPPNPLEQDVWNQAKEDQIDPLTLKEMLEDI. | |
Affinity Purified | |
RUO | |
582 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
Bardet-Biedl syndrome 1, Bardet-Biedl syndrome 1 protein, BBS2L2, BBS2-like protein 2, FLJ23590, MGC126183, MGC126184, MGC51114 | |
Rabbit | |
65 kDa | |
20 μL | |
Primary | |
Mouse | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title