Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BBS1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
| Antigen | BBS1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17968420
|
Novus Biologicals
NBP17968420UL |
20 μL |
Each for $204.00
|
|
|||||
|
NBP179684
|
Novus Biologicals
NBP179684 |
100 μL |
Each for $482.50
|
|
|||||
Description
BBS1 Polyclonal specifically detects BBS1 in Mouse samples. It is validated for Western Blot.Specifications
| BBS1 | |
| Polyclonal | |
| Rabbit | |
| NP_001028300 | |
| 582 | |
| Synthetic peptide directed towards the N terminal of human Bbs1The immunogen for this antibody is Bbs1. Peptide sequence PCVYVYKNLRPYFKFSLPQLPPNPLEQDVWNQAKEDQIDPLTLKEMLEDI. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Bardet-Biedl syndrome 1, Bardet-Biedl syndrome 1 protein, BBS2L2, BBS2-like protein 2, FLJ23590, MGC126183, MGC126184, MGC51114 | |
| BBS1 | |
| IgG | |
| 65 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title