Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BBS1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | BBS1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP17968420
|
Novus Biologicals
NBP17968420UL |
20 μL |
Each for $152.22
|
|
NBP179684
|
Novus Biologicals
NBP179684 |
100 μL |
Each for $436.00
|
|
Description
BBS1 Polyclonal specifically detects BBS1 in Mouse samples. It is validated for Western Blot.Specifications
BBS1 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
Bardet-Biedl syndrome 1, Bardet-Biedl syndrome 1 protein, BBS2L2, BBS2-like protein 2, FLJ23590, MGC126183, MGC126184, MGC51114 | |
BBS1 | |
IgG | |
Affinity Purified | |
65 kDa |
Western Blot | |
Unconjugated | |
RUO | |
NP_001028300 | |
582 | |
Synthetic peptide directed towards the N terminal of human Bbs1The immunogen for this antibody is Bbs1. Peptide sequence PCVYVYKNLRPYFKFSLPQLPPNPLEQDVWNQAKEDQIDPLTLKEMLEDI. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title