Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Bcl-6 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP276541

Catalog No. NBP276541


Add to cart

Description

Description

Bcl-6 Polyclonal antibody specifically detects Bcl-6 in Human samples. It is validated for Western Blot, Immunocytochemistry, Immunofluorescence.
Specifications

Specifications

Bcl-6
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
B-cell CLL/lymphoma 6, B-cell lymphoma 6 protein transcript, BCL-5, BCL5B-cell lymphoma 5 protein, BCL-6, BCL6A, cys-his2 zinc finger transcription factor, LAZ3ZBTB27B-cell lymphoma 6 protein, lymphoma-associated zinc finger gene on chromosome 3, Protein LAZ-3, Zinc finger and BTB domain-containing protein 27, Zinc finger protein 51ZNF51, zinc finger transcription factor BCL6S
Rabbit
IgG
100 μL
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunocytochemistry, Immunofluorescence, Western Blot
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
Affinity Purified
BCL6
This antibody was developed against Recombinant Protein corresponding to amino acids: EHVVDTCRKFIKASEAEMVSAIKPPREEFLNSRMLMPQDIMAYRGREVVENNLPLRSAPGCESRAFAPSLYSGLSTPPASYSMYSHLPVSSLLFSDEEFRDVR
Affinity purified
Cancer, Cell Cycle and Replication, Tumor Suppressors
Primary
604.0
Human
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit