Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Bcl3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP257127
Description
Bcl3 Polyclonal specifically detects Bcl3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
Bcl3 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
B-cell CLL/lymphoma 3, B-cell leukemia/lymphoma 3, B-cell lymphoma 3 protein, B-cell lymphoma 3-encoded protein, BCL-3, BCL4, chronic lymphatic leukemia protein, D19S37, Proto-oncogene BCL3 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
BCL3 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AQMYSGSSALHSASGRGLLPLVRTLVRSGADSSLKNCHNDTPLMVARSRRVIDILRGKATRPASTSQPDPSPDRSANTSPESSSRLSSN | |
100 μL | |
Adaptive Immunity, Cell Cycle and Replication, Chromatin Research, Immunology, Signal Transduction, Transcription Factors and Regulators | |
602 | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?
Provide Content Correction