Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Beta 2 Adaptin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | Beta 2 Adaptin |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Beta 2 Adaptin Polyclonal specifically detects Beta 2 Adaptin in Human samples. It is validated for Western Blot.Specifications
| Beta 2 Adaptin | |
| Polyclonal | |
| Rabbit | |
| P63010 | |
| 163 | |
| Synthetic peptides corresponding to AP2B1(adaptor-related protein complex 2, beta 1 subunit) The peptide sequence was selected from the middle region of AP2B1. Peptide sequence SETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKP. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Adapter-related protein complex 2 beta subunit, Adaptor protein complex AP-2 subunit beta, adaptor-related protein complex 2, beta 1 subunit, ADTB2adaptin, beta 2 (beta), AP105B, AP2-BETA, Beta-2-adaptin, Beta-adaptin, CLAPB1AP-2 complex subunit beta, Clathrin assembly protein complex 2 beta large chain, clathrin-associated/assembly/adaptor protein, large, beta 1, DKFZp781K0743, Plasma membrane adaptor HA2/AP2 adaptin beta subunit | |
| AP2B1 | |
| IgG | |
| This product is specific to Subunit or Isoform: beta. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title