Beta 2 Adaptin Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP258316

Catalog No. NBP258316

Description

Beta 2 Adaptin Polyclonal specifically detects Beta 2 Adaptin in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: Beta 2 Adaptin
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: Adapter-related protein complex 2 beta subunit, Adaptor protein complex AP-2 subunit beta, adaptor-related protein complex 2, beta 1 subunit, ADTB2adaptin, beta 2 (beta), AP105B, AP2-BETA, Beta-2-adaptin, Beta-adaptin, CLAPB1AP-2 complex subunit beta, Clathrin assembly protein complex 2 beta large chain, clathrin-associated/assembly/adaptor protein, large, beta 1, DKFZp781K0743, Plasma membrane adaptor HA2/AP2 adaptin beta subunit
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 163
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: AP2B1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GGLDSLVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGGYVAPKA
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only