Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

beta-3 Adrenergic R/ADRB3 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Specifications

Antigen beta-3 Adrenergic R/ADRB3
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB126636
View Documents
Novus Biologicals
NBP31086725UL
25 μg N/A
NB126635
View Documents
Novus Biologicals
NBP310867100UL
100 μg N/A
Description

Description

beta-3 Adrenergic R/ADRB3 Polyclonal antibody specifically detects beta-3 Adrenergic R/ADRB3 in Mouse samples. It is validated for Western Blot
Specifications

Specifications

beta-3 Adrenergic R/ADRB3
Western Blot
Purified
RUO
Mouse
ADRB3R, adrenergic, beta-3-, receptor, B3AR, beta-3 adrenergic receptor, Beta-3 adrenoceptor, Beta-3 adrenoreceptor, BETA3AR, FLJ99960
The immunogen is a synthetic peptide directed towards the C terminal region of mouse beta-3 Adrenergic R/ADRB3 (NP_038490.2). Peptide sequence RSPDFRDAFRRLLCSYGGRGPEEPRAVTFPASPVEARQSPPLNRFDGYEG
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
GPCR, Neuroscience
PBS buffer, 2% sucrose
155
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit