Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
beta Adducin Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | beta Adducin |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15307920
|
Novus Biologicals
NBP15307920UL |
20 μL |
Each for $152.22
|
|
NBP153079
|
Novus Biologicals
NBP153079 |
100 μL |
Each for $436.00
|
|
Description
beta Adducin Polyclonal specifically detects beta Adducin in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| beta Adducin | |
| Polyclonal | |
| Rabbit | |
| Stem Cell Markers | |
| P35612 | |
| 119 | |
| Synthetic peptides corresponding to ADD2(adducin 2 (beta)) The peptide sequence was selected from the middle region of ADD2. Peptide sequence VVNGREEEQTAEEILSKGLSQMTTSADTDVDTSKDKTESVTSGPMSPEGS. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| ADDBErythrocyte adducin subunit beta, adducin 2 (beta), beta adducin, beta-adducin | |
| ADD2 | |
| IgG | |
| Affinity Purified | |
| 80 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title