Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

beta-Catenin Mouse anti-Human, Clone: CL3691, Novus Biologicals™

Mouse Monoclonal Antibody

Manufacturer:  Novus Biologicals NBP261629

Catalog No. NBP261629


Add to cart

Description

Description

beta-Catenin Monoclonal antibody specifically detects beta-Catenin in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

beta-Catenin
CL3691
Western Blot 1 ug/ml, Immunohistochemistry 1:10000 - 1:20000
Purified
CTNNB1
This antibody was developed against a recombinant protein corresponding to amino acids: SYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAH
Protein A purified
Cancer, Cellular Markers, Cytoskeleton Markers, Extracellular Matrix, Immune System Diseases, Mucosal Immunology, Neuroscience, Signal Transduction, Stem Cell Signaling Pathway, Wnt Signaling Pathway
Primary
1499
Human
Immunohistochemistry, Western Blot
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
beta 1 (88kD), beta-catenin, catenin (cadherin-associated protein), beta 1, 88kDa, catenin beta-1, CTNNB, DKFZp686D02253, FLJ25606, FLJ37923
Mouse
IgG1
100 ul
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Monoclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit