Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

beta-Defensin 4/2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen beta-Defensin 4/2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP17979220
View Documents
Novus Biologicals
NBP17979220UL
20 μL
Each for $152.22
Add to cart
 
NBP179792
View Documents
Novus Biologicals
NBP179792
100 μL
Each for $436.00
Add to cart
 
Description

Description

beta-Defensin 4/2 Polyclonal specifically detects beta-Defensin 4/2 in Human samples. It is validated for Western Blot.
Specifications

Specifications

beta-Defensin 4/2
Polyclonal
Rabbit
Human
NP_004933
1673
Synthetic peptide directed towards the N terminal of human DEFB4AThe immunogen for this antibody is DEFB4A. Peptide sequence LLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGL.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
Beta-defensin 2, DEFB-2, DEFB2DEFB102, DEFB4beta-defensin 4A, Defensin, beta 2Skin-antimicrobial peptide 1, defensin, beta 4, defensin, beta 4A, HBD-2, SAP1BD-2
DEFB4A
IgG
Affinity Purified
4 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit