Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
beta-Defensin 4/2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | beta-Defensin 4/2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17979220
|
Novus Biologicals
NBP17979220UL |
20 μL |
Each for $152.22
|
|
NBP179792
|
Novus Biologicals
NBP179792 |
100 μL |
Each for $436.00
|
|
Description
beta-Defensin 4/2 Polyclonal specifically detects beta-Defensin 4/2 in Human samples. It is validated for Western Blot.Specifications
| beta-Defensin 4/2 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| NP_004933 | |
| 1673 | |
| Synthetic peptide directed towards the N terminal of human DEFB4AThe immunogen for this antibody is DEFB4A. Peptide sequence LLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Beta-defensin 2, DEFB-2, DEFB2DEFB102, DEFB4beta-defensin 4A, Defensin, beta 2Skin-antimicrobial peptide 1, defensin, beta 4, defensin, beta 4A, HBD-2, SAP1BD-2 | |
| DEFB4A | |
| IgG | |
| Affinity Purified | |
| 4 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title