Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
beta ureidopropionase Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | beta ureidopropionase |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP154393
|
Novus Biologicals
NBP154393 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
beta ureidopropionase Polyclonal specifically detects beta ureidopropionase in Human samples. It is validated for Western Blot.Specifications
| beta ureidopropionase | |
| Polyclonal | |
| Purified | |
| RUO | |
| Q9UBR1 | |
| 51733 | |
| Synthetic peptides corresponding to UPB1(ureidopropionase, beta) The peptide sequence was selected from the middle region of UPB1. Peptide sequence AVVISNSGAVLGKTRKNHIPRVGDFNESTYYMEGNLGHPVFQTQFGRIAV. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Beta-alanine synthase, beta-ureidopropionase, BUP-1, BUP1EC 3.5.1.6, N-carbamoyl-beta-alanine amidohydrolase, ureidopropionase, beta | |
| UPB1 | |
| IgG | |
| Protein A purified | |
| 42 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title