Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Biliverdin Reductase B/BLVRB Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15306820UL

 View more versions of this product

Catalog No. NBP15306820


Add to cart

Description

Description

Biliverdin Reductase B/BLVRB Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

Biliverdin Reductase B/BLVRB
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
BLVRB
Synthetic peptides corresponding to BLVRB(biliverdin reductase B (flavin reductase (NADPH))) The peptide sequence was selected from the middle region of BLVRB. Peptide sequence GLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTD.
22 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Western Blot
Western Blot 1:100-1:2000
P30043
Biliverdin reductase B, biliverdin reductase B (flavin reductase (NADPH)), Biliverdin-IX beta-reductase, BVR-B, EC 1.3.1.24, EC 1.5.1.30, flavin reductase, flavin reductase (NADPH), FLRBVRB, FR, GHBP, Green heme-binding protein, MGC117413, NADPH-dependent diaphorase, NADPH-flavin reductase, SDR43U1, short chain dehydrogenase/reductase family 43U, member 1
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
645
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit