Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BLZF1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | BLZF1 |
---|---|
Dilution | Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin |
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NB125849
|
Novus Biologicals
NBP310474100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
BLZF1 Polyclonal specifically detects BLZF1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
BLZF1 | |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
Human | |
basic leucine zipper nuclear factor 1JEM-1s, cytoplasmic protein, GOLGIN-45, JEM1, JEM-1MGC22497, JEM-1short protein, p45 basic leucine-zipper nuclear factor | |
The immunogen is a synthetic peptide directed towards the C terminal region of human BLZF1 (NP_003657). Peptide sequence DPVTCKESSPDNPFFESSPTTLLATKKNIGRFHPYTRYENITFNCCNHCR | |
Affinity purified |
Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin | |
Polyclonal | |
Purified | |
RUO | |
PBS buffer, 2% sucrose | |
8548 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title