Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

BMP2K Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15290120UL

 View more versions of this product

Catalog No. NBP1529020


Add to Cart

Description

Description

BMP2K Polyclonal specifically detects BMP2K in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

BMP2K
Polyclonal
Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Q4W5H2
BMP2K
Synthetic peptides corresponding to BMP2K(BMP2 inducible kinase) The peptide sequence was selected from the C terminal of BMP2K. Peptide sequence AQHQPSQQQASPEYLTSPQEFSPALVSYTSSLPAQVGTIMDSSYSANRSV.
Protein A purified
RUO
Primary
Human
Purified
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
BIKe, BMP2 inducible kinase, BMP-2-inducible protein kinase, DKFZp434K0614, DKFZp434P0116, EC 2.7.11.1
Rabbit
74 kDa
20 μL
Protein Kinase, Stem Cell Signaling Pathway
55589
Store at -20C. Avoid freeze-thaw cycles.
IgG
Product Suggestions

Product Suggestions

SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit