Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BMP2K Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | BMP2K |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP152902
|
Novus Biologicals
NBP152902 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
BMP2K Polyclonal specifically detects BMP2K in Human samples. It is validated for Western Blot.Specifications
BMP2K | |
Polyclonal | |
Rabbit | |
Protein Kinase, Stem Cell Signaling Pathway | |
BIKe, BMP2 inducible kinase, BMP-2-inducible protein kinase, DKFZp434K0614, DKFZp434P0116, EC 2.7.11.1 | |
BMP2K | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
Q4W5H2 | |
55589 | |
Synthetic peptides corresponding to BMP2K(BMP2 inducible kinase) The peptide sequence was selected from the middle region of BMP2K. Peptide sequence VKVLAPGEFGNHRPKGALRPGNGPEILLGQGPPQQPPQQHRVLQQLQQGD. | |
Primary |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title