BMP2K Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP152901

Catalog No. NBP152901

Description

BMP2K Polyclonal specifically detects BMP2K in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: BMP2K
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: Q4W5H2
• Gene Symbols: BMP2K
• Immunogen: Synthetic peptides corresponding to BMP2K(BMP2 inducible kinase) The peptide sequence was selected from the C terminal of BMP2K. Peptide sequence AQHQPSQQQASPEYLTSPQEFSPALVSYTSSLPAQVGTIMDSSYSANRSV.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: BIKe, BMP2 inducible kinase, BMP-2-inducible protein kinase, DKFZp434K0614, DKFZp434P0116, EC 2.7.11.1
• Host Species: Rabbit
• Molecular Weight of Antigen: 74 kDa
• Quantity: 100 μL
• Research Discipline: Protein Kinase, Stem Cell Signaling Pathway
• Gene ID (Entrez): 55589
• Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Rabbit
• Form: Purified