Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

BMP2K Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen BMP2K
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Form Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP1529020
View Documents
Novus Biologicals
NBP15290120UL
20 μL
Each for $152.22
Add to cart
 
NBP152901
View Documents
Novus Biologicals
NBP152901
100 μL
Each for $436.00
Add to cart
 
Description

Description

BMP2K Polyclonal specifically detects BMP2K in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

BMP2K
Polyclonal
Purified
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
BIKe, BMP2 inducible kinase, BMP-2-inducible protein kinase, DKFZp434K0614, DKFZp434P0116, EC 2.7.11.1
BMP2K
IgG
Protein A purified
74 kDa
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
Rabbit
Protein Kinase, Stem Cell Signaling Pathway
Q4W5H2
55589
Synthetic peptides corresponding to BMP2K(BMP2 inducible kinase) The peptide sequence was selected from the C terminal of BMP2K. Peptide sequence AQHQPSQQQASPEYLTSPQEFSPALVSYTSSLPAQVGTIMDSSYSANRSV.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit