Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

BMP2K Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$204.00 - $482.50


Antigen BMP2K
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Form Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
View Documents
Novus Biologicals
20 μL
Each for $204.00
Add to Cart
View Documents
Novus Biologicals
100 μL
Each for $482.50
Add to Cart


BMP2K Polyclonal specifically detects BMP2K in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.


Synthetic peptides corresponding to BMP2K(BMP2 inducible kinase) The peptide sequence was selected from the C terminal of BMP2K. Peptide sequence AQHQPSQQQASPEYLTSPQEFSPALVSYTSSLPAQVGTIMDSSYSANRSV.
74 kDa
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Protein Kinase, Stem Cell Signaling Pathway
BIKe, BMP2 inducible kinase, BMP-2-inducible protein kinase, DKFZp434K0614, DKFZp434P0116, EC
Protein A purified


Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit