Learn More
Abnova™ BMP7 Recombinant Protein
Human full-length ORF recombinant protein with GST-tag at N-terminal.
Supplier: Abnova™ H00000655P0110
Description
- Bone morphogenetic proteins (BMPs) belongs to family of secreted signaling molecules
- Induces ectopic bone growth
- Molecular weight: 73.15kDa
- Preparation method:in vitro wheat germ expression system
- Purification: glutathione Sepharose 4 fast flow
- Storage buffer: 50 mM Tris-HCI, 10 mM reduced glutathione
- pH=8.0 in the elution buffer
Sequence: MHVRSLRAAAPHSFVALWAPLFLLRSALADFSLDNEVHSSFIHRRLRSQERREMQREILSILGLPHRPRPHLQGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQDSHFLTDADMVMSFVNLVEHDKEFFHPRYHHREFRFDLSKIPEGEAVTAAEFRIYKDYIRERFDNE
TFRISVYQVLQEHLGRESDLFLLDSRTLWASEEGWLVFDITATSNHWVVNPRHNLGLQLSVETLDGQSINPKLAGLIGRHGPQNKQPFMVAFFKATEVHFRSIRSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH
Best when used within three months from the date of receipt of this protein.
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifications
AAH08584 | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
73.15 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
BMP7 | |
Human | |
Recombinant | |
Solution |
Antibody Production, Protein Array, ELISA, Western Blot | |
655 | |
BMP7 (Human) Recombinant Protein (P01) | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Wheat Germ (in vitro) | |
OP-1 | |
BMP7 | |
Wheat Germ (in vitro) | |
GST |
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.