Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BNC1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16899620UL
Description
BNC1 Polyclonal specifically detects BNC1 in Mouse samples. It is validated for Western Blot.Specifications
BNC1 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
basonuclin, basonuclin 1, BNC, BSN1, HsT19447, zinc finger protein basonuclin, zinc finger protein basonuclin-1 | |
Rabbit | |
110 kDa | |
20 μL | |
Primary | |
Mouse | |
IgG |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
BNC1 | |
Synthetic peptides corresponding to Bnc1 (basonuclin 1) The peptide sequence was selected from the C terminal of Bnc1. Peptide sequence ETSEDHFRAAYLLQDVAKEAYQDVAFTPQASQTSVIFKGTSGMGSLVYPI. | |
Affinity Purified | |
RUO | |
646 | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title