Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BNC1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP168996
Description
BNC1 Polyclonal specifically detects BNC1 in Mouse samples. It is validated for Western Blot.Specifications
BNC1 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
BNC1 | |
Synthetic peptides corresponding to Bnc1 (basonuclin 1) The peptide sequence was selected from the C terminal of Bnc1. Peptide sequence ETSEDHFRAAYLLQDVAKEAYQDVAFTPQASQTSVIFKGTSGMGSLVYPI. | |
Affinity purified | |
RUO | |
646 | |
Human, Mouse, Rat, Porcine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
basonuclin, basonuclin 1, BNC, BSN1, HsT19447, zinc finger protein basonuclin, zinc finger protein basonuclin-1 | |
Rabbit | |
110 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction