Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BNC1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | BNC1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP16899620
|
Novus Biologicals
NBP16899620UL |
20 μL |
Each for $152.22
|
|
NBP168996
|
Novus Biologicals
NBP168996 |
100 μL |
Each for $436.00
|
|
Description
BNC1 Polyclonal specifically detects BNC1 in Mouse samples. It is validated for Western Blot.Specifications
BNC1 | |
Polyclonal | |
Rabbit | |
basonuclin, basonuclin 1, BNC, BSN1, HsT19447, zinc finger protein basonuclin, zinc finger protein basonuclin-1 | |
BNC1 | |
IgG | |
Affinity Purified | |
110 kDa |
Western Blot | |
Unconjugated | |
RUO | |
646 | |
Synthetic peptides corresponding to Bnc1 (basonuclin 1) The peptide sequence was selected from the C terminal of Bnc1. Peptide sequence ETSEDHFRAAYLLQDVAKEAYQDVAFTPQASQTSVIFKGTSGMGSLVYPI. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title