Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BNC2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16907820UL
Description
BNC2 Polyclonal specifically detects BNC2 in Mouse samples. It is validated for Western Blot.Specifications
BNC2 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
basonuclin 2, BSN2, DKFZp686A01127, FLJ20043, FLJ34928, zinc finger protein basonuclin-2 | |
Rabbit | |
116 kDa | |
20 μL | |
Primary | |
Mouse | |
IgG |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
BNC2 | |
Synthetic peptides corresponding to Bnc2 (basonuclin 2) The peptide sequence was selected from the C terminal of Bnc2. Peptide sequence GTLRVHYKTVHLREMHKCKVPGCNMMFSSVRSRNRHSQNPNLHKNIPFTS. | |
Affinity Purified | |
RUO | |
54796 | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title