Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

BNC2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen BNC2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP16907820
View Documents
Novus Biologicals
NBP16907820UL
20 μL
Each for $152.22
Add to cart
 
NBP169078
View Documents
Novus Biologicals
NBP169078
100 μL
Each for $436.00
Add to cart
 
Description

Description

BNC2 Polyclonal specifically detects BNC2 in Mouse samples. It is validated for Western Blot.
Specifications

Specifications

BNC2
Polyclonal
Rabbit
basonuclin 2, BSN2, DKFZp686A01127, FLJ20043, FLJ34928, zinc finger protein basonuclin-2
BNC2
IgG
Affinity Purified
116 kDa
Western Blot
Unconjugated
RUO
54796
Synthetic peptides corresponding to Bnc2 (basonuclin 2) The peptide sequence was selected from the C terminal of Bnc2. Peptide sequence GTLRVHYKTVHLREMHKCKVPGCNMMFSSVRSRNRHSQNPNLHKNIPFTS.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit