Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BNC2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | BNC2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP16907820
|
Novus Biologicals
NBP16907820UL |
20 μL |
Each for $152.22
|
|
NBP169078
|
Novus Biologicals
NBP169078 |
100 μL |
Each for $436.00
|
|
Description
BNC2 Polyclonal specifically detects BNC2 in Mouse samples. It is validated for Western Blot.Specifications
| BNC2 | |
| Polyclonal | |
| Rabbit | |
| basonuclin 2, BSN2, DKFZp686A01127, FLJ20043, FLJ34928, zinc finger protein basonuclin-2 | |
| BNC2 | |
| IgG | |
| Affinity Purified | |
| 116 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 54796 | |
| Synthetic peptides corresponding to Bnc2 (basonuclin 2) The peptide sequence was selected from the C terminal of Bnc2. Peptide sequence GTLRVHYKTVHLREMHKCKVPGCNMMFSSVRSRNRHSQNPNLHKNIPFTS. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title