Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BPGM Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | BPGM |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15318620
|
Novus Biologicals
NBP15318620UL |
20 μL |
Each for $152.22
|
|
NBP153186
|
Novus Biologicals
NBP153186 |
100 μL |
Each for $436.00
|
|
Description
BPGM Polyclonal specifically detects BPGM in Human samples. It is validated for Western Blot.Specifications
| BPGM | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 2,3-bisphosphoglycerate mutase, bisphosphoglycerate mutase, BPG-dependent PGAM, EC 3.1.3.132,3-bisphosphoglycerate synthase, EC 5.4.2.1, EC 5.4.2.4, erythrocyte 2,3-bisphosphoglycerate mutase2,3-bisphosphoglycerate mutase, erythrocyte | |
| BPGM | |
| IgG | |
| Affinity Purified | |
| 28 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| P07738 | |
| 669 | |
| Synthetic peptides corresponding to BPGM(2,3-bisphosphoglycerate mutase) The peptide sequence was selected from the C terminal of BPGM. Peptide sequence LPTGVPILLELDENLRAVGPHQFLGDQEAIQAAIKKVEDQGKVKQAKK. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title