Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

BPGM Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen BPGM
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15318620
View Documents
Novus Biologicals
NBP15318620UL
20 μL
Each for $152.22
Add to cart
 
NBP153186
View Documents
Novus Biologicals
NBP153186
100 μL
Each for $436.00
Add to cart
 
Description

Description

BPGM Polyclonal specifically detects BPGM in Human samples. It is validated for Western Blot.
Specifications

Specifications

BPGM
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
2,3-bisphosphoglycerate mutase, bisphosphoglycerate mutase, BPG-dependent PGAM, EC 3.1.3.132,3-bisphosphoglycerate synthase, EC 5.4.2.1, EC 5.4.2.4, erythrocyte 2,3-bisphosphoglycerate mutase2,3-bisphosphoglycerate mutase, erythrocyte
BPGM
IgG
Affinity Purified
28 kDa
Western Blot
Unconjugated
RUO
P07738
669
Synthetic peptides corresponding to BPGM(2,3-bisphosphoglycerate mutase) The peptide sequence was selected from the C terminal of BPGM. Peptide sequence LPTGVPILLELDENLRAVGPHQFLGDQEAIQAAIKKVEDQGKVKQAKK.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit