Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BRDT Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18029420UL
Description
BRDT Polyclonal specifically detects BRDT in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
BRDT | |
Polyclonal | |
Western Blot 1:1000 | |
NP_001717 | |
BRDT | |
Synthetic peptide directed towards the N terminal of human BRDT. Peptide sequence MSLPSRQTAIIVNPPPPEYINTKKNGRLTNQLQYLQKVVLKDLWKHSFSW. | |
20 μL | |
Protein Kinase | |
676 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
bromodomain testis-specific protein, bromodomain, testis-specific, Cancer/testis antigen 9, CT9BRD6, RING3-like protein | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction