Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BRDT Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | BRDT |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP18029420
|
Novus Biologicals
NBP18029420UL |
20 μL |
Each for $152.22
|
|
NBP180294
|
Novus Biologicals
NBP180294 |
100 μL |
Each for $436.00
|
|
Description
BRDT Polyclonal specifically detects BRDT in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| BRDT | |
| Unconjugated | |
| RUO | |
| NP_001717 | |
| 676 | |
| Synthetic peptide directed towards the N terminal of human BRDT. Peptide sequence MSLPSRQTAIIVNPPPPEYINTKKNGRLTNQLQYLQKVVLKDLWKHSFSW. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Polyclonal | |
| Rabbit | |
| Protein Kinase | |
| bromodomain testis-specific protein, bromodomain, testis-specific, Cancer/testis antigen 9, CT9BRD6, RING3-like protein | |
| BRDT | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title