Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Breast carcinoma amplified sequence 3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP258584
Description
Breast carcinoma amplified sequence 3 Polyclonal specifically detects Breast carcinoma amplified sequence 3 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
Breast carcinoma amplified sequence 3 | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
BCAS4/BCAS3 fusion, breast carcinoma amplified sequence 3, breast carcinoma amplified sequence 4/3 fusion protein, breast carcinoma-amplified sequence 3, DKFZp686O1527, FLJ20128, GAOB1, MAAB, metastasis associated antigen of breast cancer, MGC4973, protein Maab1 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
BCAS3 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGSEPPLLIMIGYSDGMQVWSIPISGEAQ | |
100 μL | |
Cancer | |
54828 | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
For Research Use Only