Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BRPF3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
Antigen | BRPF3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
BRPF3 Polyclonal specifically detects BRPF3 in Human samples. It is validated for Western Blot.Specifications
BRPF3 | |
Polyclonal | |
Rabbit | |
NP_056510 | |
27154 | |
Synthetic peptide directed towards the N terminal of human BRPF3The immunogen for this antibody is BRPF3. Peptide sequence CNSNKENSEQPQFPGKSKKPSSKGKKKESCSKHASGTSFHLPQPSFRMVD. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
bromodomain and PHD finger containing, 3, bromodomain and PHD finger-containing protein 3, KIAA1286 | |
BRPF3 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title