Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

BRPF3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP17938220UL

 View more versions of this product

Catalog No. NBP17938220


Add to cart

Description

Description

BRPF3 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

BRPF3
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
BRPF3
Synthetic peptide directed towards the N terminal of human BRPF3The immunogen for this antibody is BRPF3. Peptide sequence CNSNKENSEQPQFPGKSKKPSSKGKKKESCSKHASGTSFHLPQPSFRMVD.
Immunogen affinity purified
RUO
Primary
27154
Western Blot
Western Blot 1:1000
NP_056510
bromodomain and PHD finger containing, 3, bromodomain and PHD finger-containing protein 3, KIAA1286
Rabbit
IgG
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit