Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

BRUNOL5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen BRUNOL5
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP157522
View Documents
Novus Biologicals
NBP157522
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

BRUNOL5 Polyclonal specifically detects BRUNOL5 in Human samples. It is validated for Western Blot.
Specifications

Specifications

BRUNOL5
Polyclonal
Rabbit
Q8N6W0
60680
Synthetic peptides corresponding to BRUNOL5 (CUGBP, Elav-like family member 5) The peptide sequence was selected from the middle region of BRUNOL5)(50ug). Peptide sequence AFSGVQQYTAMYPTAAITPIAHSVPQPPPLLQQQQREGPEGCNLFIYHLP.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
Bruno (Drosophila) -like 5, RNA binding protein, BRUNOL-5, BRUNOL5bruno-like 5, RNA binding protein (Drosophila), bruno-like 5 RNA binding protein, Bruno-like protein 5, CELF-5, CUG-BP and ETR-3 like factor 5, CUG-BP- and ETR-3-like factor 5, CUGBP Elav-like family member 5, CUGBP, Elav-like family member 5, RNA-binding protein BRUNOL-5
CELF5
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit