Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BRUNOL6 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | BRUNOL6 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157256
|
Novus Biologicals
NBP157256 |
100 μL |
Each for $436.00
|
|
NBP15725620
|
Novus Biologicals
NBP15725620UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
BRUNOL6 Polyclonal specifically detects BRUNOL6 in Human samples. It is validated for Western Blot.Specifications
| BRUNOL6 | |
| Polyclonal | |
| Rabbit | |
| Q96J87 | |
| 60677 | |
| Synthetic peptides corresponding to BRUNOL6(bruno-like 6, RNA binding protein (Drosophila)) The peptide sequence was selected from the middle region of BRUNOL6. Peptide sequence QAALLAAAQGPGLGPVAAVAAQMQHVAAFSLVAAPLLPAAAANSPPGSGP. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Bruno (Drosophila) -like 6, RNA binding protein, Bruno -like 6, RNA binding protein, BRUNOL6bruno-like 6, RNA binding protein (Drosophila), bruno-like 6, RNA binding protein, Bruno-like protein 6, CELF-6, CUG-BP and ETR-3 like factor 6, CUG-BP- and ETR-3-like factor 6, CUGBP Elav-like family member 6, CUGBP, Elav-like family member 6, RNA-binding protein BRUNOL-6 | |
| CELF6 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title