Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BSX Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP31060225UL
Description
BSX Polyclonal specifically detects BSX in Mouse samples. It is validated for Western Blot.Specifications
BSX | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
brain-specific homeobox, brain-specific homeobox protein homolog, BSX1 | |
The immunogen is a synthetic peptide directed towards the middle region of MOUSE BSX (NP_839976). Peptide sequence RRMKHKKQLRKSQDEPKAADGPESPEGSPRAPEGAPADARLSLPAGAFVL | |
25 μg | |
Primary | |
Mouse | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
390259 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction