Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

BTBD10 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP180088

 View more versions of this product

Catalog No. NBP180088


Add to cart

Description

Description

BTBD10 Polyclonal antibody specifically detects BTBD10 in Human, Mouse, Rat, Canine, Equine, Guinea Pig, Rabbit samples. It is validated for Western Blot.
Specifications

Specifications

BTBD10
Unconjugated
PBS & 2% Sucrose. with 0.09% Sodium Azide
Affinity Purified
BTBD10
Synthetic peptide directed towards the N terminal of human BTBD10. Peptide sequence AGRPHPYDGNSSDPENWDRKLHSRPRKLYKHSSTSSRIAKGGVDHTKMSL.
Immunogen affinity purified
RUO
Primary
84280
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:1000
NP_115696
BTB (broad-complex tramtrack and bric-a-brac/pox virus and zinc finger)domain-containing protein 10, BTB (POZ) domain containing 10, BTB/POZ domain-containing protein 10, GMRP1, GMRP-1, K+ channel tetramerization protein, KSARCOSIN, MGC13007
Rabbit
IgG
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Human: 100%; Chicken: 92%; Xenopus: 85%; Equine: 85%; Pig: 85%; Rat: 85%; Mouse: 78%.
Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit