Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BTN2A1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16237120UL
Description
BTN2A1 Polyclonal specifically detects BTN2A1 in Human samples. It is validated for Western Blot.Specifications
BTN2A1 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q7KYR7 | |
BTN2A1 | |
Synthetic peptides corresponding to BTN2A1(butyrophilin, subfamily 2, member A1) The peptide sequence was selected from the N terminal of BTN2A1. Peptide sequence SVALVIHNITAQENGTYRCYFQEGRSYDEAILHLVVAGLGSKPLISMRGH. | |
Affinity Purified | |
RUO | |
11120 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
BK14H9.1, BTF1BT2.1butyrophilin BTF1, butyrophilin subfamily 2 member A1, butyrophilin, subfamily 2, member A1, DJ3E1.1, FLJ36567 | |
Rabbit | |
57 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction