Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

BUD31 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP310475100UL

 View more versions of this product

Catalog No. NB125851


Add to cart

Description

Description

BUD31 Polyclonal antibody specifically detects BUD31 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications

Specifications

BUD31
Unconjugated
PBS buffer, 2% sucrose
BUD31 homolog (S. cerevisiae), BUD31 homolog (yeast), EDG-2, EDG2MGC111202, fSAP17, functional spliceosome-associated protein 17, G10, G10 maternal transcript homolog, maternal G10 transcript, protein BUD31 homolog, Protein EDG-2, Protein G10 homolog, YCR063W
The immunogen is a synthetic peptide directed towards the N terminal region of human BUD31 (NP_003901). Peptide sequence PKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFR
100 μg
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Polyclonal
Human
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
Purified
Rabbit
Affinity purified
RUO
Primary
8896
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit