Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

BUD31 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen BUD31
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB125851
View Documents
Novus Biologicals
NBP310475100UL
100 μg
Each for $352.89
Add to cart
 
NB125852
View Documents
Novus Biologicals
NBP31047525UL
25 μg
Each for $106.19
Add to cart
 
Description

Description

BUD31 Polyclonal antibody specifically detects BUD31 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications

Specifications

BUD31
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Purified
RUO
PBS buffer, 2% sucrose
8896
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
Unconjugated
Rabbit
Human
BUD31 homolog (S. cerevisiae), BUD31 homolog (yeast), EDG-2, EDG2MGC111202, fSAP17, functional spliceosome-associated protein 17, G10, G10 maternal transcript homolog, maternal G10 transcript, protein BUD31 homolog, Protein EDG-2, Protein G10 homolog, YCR063W
The immunogen is a synthetic peptide directed towards the N terminal region of human BUD31 (NP_003901). Peptide sequence PKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFR
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit