Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BXDC5 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | BXDC5 |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP180467
|
Novus Biologicals
NBP180467 |
100 μL |
Each for $436.00
|
|
NBP18046720
|
Novus Biologicals
NBP18046720UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
BXDC5 Polyclonal specifically detects BXDC5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
BXDC5 | |
Polyclonal | |
Rabbit | |
NP_079341 | |
80135 | |
Synthetic peptide directed towards the N terminal of human BXDC5. Peptide sequence AAAFPPGFSISEIKNKQRRHLMFTRWKQQQRKEKLAAKKKLKKEREALGD. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
2310066N05Rik, BBR140, brix domain containing 5, Brix domain-containing protein 5, BXDC5, DKFZp761G0415, DKFZp761M0215, FLJ12475, Ribosome biogenesis protein RPF1, ribosome production factor 1, ribosome production factor 1 homolog (S. cerevisiae), RNA processing factor 1 (RPF1), RP11-118B23.1 | |
RPF1 | |
IgG | |
Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title