Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

BXDC5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen BXDC5
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP180467
View Documents
Novus Biologicals
NBP180467
100 μL
Each for $436.00
Add to cart
 
NBP18046720
View Documents
Novus Biologicals
NBP18046720UL
20 μL This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. N/A
Description

Description

BXDC5 Polyclonal specifically detects BXDC5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

BXDC5
Polyclonal
Rabbit
NP_079341
80135
Synthetic peptide directed towards the N terminal of human BXDC5. Peptide sequence AAAFPPGFSISEIKNKQRRHLMFTRWKQQQRKEKLAAKKKLKKEREALGD.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
RUO
2310066N05Rik, BBR140, brix domain containing 5, Brix domain-containing protein 5, BXDC5, DKFZp761G0415, DKFZp761M0215, FLJ12475, Ribosome biogenesis protein RPF1, ribosome production factor 1, ribosome production factor 1 homolog (S. cerevisiae), RNA processing factor 1 (RPF1), RP11-118B23.1
RPF1
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit